The domain within your query sequence starts at position 195 and ends at position 342; the E-value for the NAD_Gly3P_dh_C domain shown below is 6.8e-51.

DADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAKIFCKGQVSTATF
LESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKELLNGQKLQGPQTSAEVYRILRQ
KGLLDKFPLFTAVYQICYEGRPVTQMLS

NAD_Gly3P_dh_C

NAD_Gly3P_dh_C
PFAM accession number:PF07479
Interpro abstract (IPR006109):

NAD-dependent glycerol-3-phosphate dehydrogenase ( EC 1.1.1.8 ) (GPD) catalyzes the reversible reduction of dihydroxyacetone phosphate to glycerol-3-phosphate. It is a cytoplasmic protein, active as a homodimer [ (PUBMED:2500660) ], each monomer containing an N-terminal NAD binding site [ (PUBMED:6773774) ]. In insects, it acts in conjunction with a mitochondrial alpha-glycerophosphate oxidase in the alpha-glycerophosphate cycle, which is essential for the production of energy used in insect flight [ (PUBMED:2500660) ].

GO process:carbohydrate metabolic process (GO:0005975), oxidation-reduction process (GO:0055114)
GO function:glycerol-3-phosphate dehydrogenase [NAD+] activity (GO:0004367)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_Gly3P_dh_C