The domain within your query sequence starts at position 6 and ends at position 207; the E-value for the NAD_binding_10 domain shown below is 1.4e-9.

CLVTGAGGFLGQRIIQLLVQEEDLEEIRVLDKVFRPETRKEFFNLETSIKVTVLEGDILD
TQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFIFSSS
VDVAGPNSYKEIVLNGHEEECHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQTCAL
RPMCIYGERSPLISNIIIMALK

NAD_binding_10

NAD_binding_10
PFAM accession number:PF13460
Interpro abstract (IPR016040):

This entry represents NAD- and NADP-binding domains with a core Rossmann-type fold, which consists of 3-layers alpha/beta/alpha, where the six beta strands are parallel in the order 321456. Many different enzymes contain an NAD/NADP-binding domain, including:

  • C-terminal domain of alcohol dehydrogenases [(PUBMED:15449945)]
  • Tyrosine-dependent oxidoreductases (also known as short-chain dehydrogenases) [(PUBMED:9174344)]
  • N-terminal domain of glyceraldehyde-3-phosphate dehydrogenase [(PUBMED:10448043)]
  • NAD-binding domain of formate/glycerate dehydrogenases [(PUBMED:8114093)]
  • N-terminal domain of sirohaem synthase [(PUBMED:14595395)]
  • N-terminal domain of lactate dehydrogenase [(PUBMED:11276087)]
  • N-terminal domain of 6-phosphogluconate dehydrogenase (the beta-sheet is extended to 8 strands) [(PUBMED:17222187)]
  • C-terminal domain of amino acid dehydrogenases (an extra N-terminal helix displaces the C-terminal helix [(PUBMED:8591026)]
  • NAD-binding domain of certain potassium channels [(PUBMED:11301020)]
  • C-terminal domain of the transcriptional repressor Rex [(PUBMED:15642260)]
  • Ornithine cyclodeaminase [(PUBMED:15518536)]
  • CoA-binding N-terminal domain of the alpha chain of succinyl-CoA synthetase [(PUBMED:9917402)]

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_binding_10