The domain within your query sequence starts at position 202 and ends at position 329; the E-value for the NAD_binding_11 domain shown below is 6.1e-36.
GTGQSAKICNNMLLAISMIGTAEAMNLGIRSGLDPKLLAKILNMSSGRCWSSDTYNPVPG VMHGVPSSNNYQGGFGTTLMAKDLGLAQDSATSTKTPILLGSLAHQIYRMMCSKGYSKKD FSSVFQYL
NAD_binding_11 |
---|
PFAM accession number: | PF14833 |
---|---|
Interpro abstract (IPR029154): | 3-Hydroxyisobutyrate is a central metabolite in the valine catabolic pathway, and is reversibly oxidised to methylmalonate semi-aldehyde by a specific dehydrogenase belonging to the 3-hydroxyacid dehydrogenase family. This entry represents the NAD-binding domain of 6-phosphogluconate dehydrogenase that adopts a Rossmann fold [ (PUBMED:16126223) ]. |
GO function: | NAD binding (GO:0051287) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_binding_11