The domain within your query sequence starts at position 423 and ends at position 544; the E-value for the NAD_binding_11 domain shown below is 2.7e-25.

VGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNI
LQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYR
AY

NAD_binding_11

NAD_binding_11
PFAM accession number:PF14833
Interpro abstract (IPR029154):

3-Hydroxyisobutyrate is a central metabolite in the valine catabolic pathway, and is reversibly oxidised to methylmalonate semi-aldehyde by a specific dehydrogenase belonging to the 3-hydroxyacid dehydrogenase family. This entry represents the NAD-binding domain of 6-phosphogluconate dehydrogenase that adopts a Rossmann fold [(PUBMED:16126223)].

GO function:NAD binding (GO:0051287)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_binding_11