The domain within your query sequence starts at position 394 and ends at position 439; the E-value for the NAD_binding_6 domain shown below is 2.3e-7.
YEVAVLVGAGIGVTPFASILKSIWYKFQRADNKLKTQKAGHAALNF
NAD_binding_6 |
 |
|---|
| PFAM accession number: | PF08030 |
|---|---|
| Interpro abstract (IPR013121): | This entry contains ferric reductase NAD binding proteins. |
| GO process: | oxidation-reduction process (GO:0055114) |
| GO function: | oxidoreductase activity (GO:0016491) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_binding_6