The domain within your query sequence starts at position 29 and ends at position 96; the E-value for the NAD_binding_8 domain shown below is 6.3e-19.

VIGAGLAGLAAARALLEQGFTDVTVLEASSHIGGRVQSVRLGDTTFELGATWIHGSHGNP
IYQLAEAN

NAD_binding_8

NAD_binding_8
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_binding_8