The domain within your query sequence starts at position 58 and ends at position 312; the E-value for the NAD_kinase domain shown below is 3.9e-12.

RVVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSL
RDEGIEVRLVKRREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSE
GHLCLPVRYTHSFPEALRRFSRGEFRWLWRQRIRLYLEGTGINPTPVDLHEQQLSLNQHS
RAFNIERAHDERSEASGPQLLPVRALNEVFIGESLSSRASYYEISVDDGPWEKQKSSGLN
LCTGTGSKAWSFNIN

NAD_kinase

NAD_kinase
PFAM accession number:PF01513
Interpro abstract (IPR002504): Members of this family are NAD kinases EC 2.7.1.23. The enzymes catalyse the phosphorylation of NAD to NADP utilizing ATP and other nucleoside triphosphates, as well as inorganic polyphosphate, as a source of phosphorus. Such enzymes are thus designated poly(P)/ATP-NAD kinases [(PUBMED:11006082)]. NAD kinase is one of the key enzymes regulating the cellular NADP(H) level, and therefore NADPH-dependent reductive biosynthetic pathways [(PUBMED:22056937)].
GO process:NADP biosynthetic process (GO:0006741), metabolic process (GO:0008152)
GO function:NAD+ kinase activity (GO:0003951)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_kinase