The domain within your query sequence starts at position 128 and ends at position 463; the E-value for the NAGLU domain shown below is 8.2e-150.

RYYQNVCTHSYSFVWWDWARWEQEIDWMALNGINLALAWNGQEAIWQRVYLALGLTQSEI
DTYFTGPAFLAWGRMGNLHTWDGPLPRSWHLSQVYLQHRILDRMRSFGMIPVLPAFAGHV
PKAITRVFPQVNVIKLGSWGHFNCSYSCSFLLAPGDPMFPLIGNLFLRELTKEFGTDHIY
GADTFNEMQPPFSDPSYLAATTAAVYEAMVTVDPDAVWLLQGWLFQHQPQFWGPSQIRAV
LEAVPRGRLLVLDLFAESHPVYMHTASFHGQPFIWCMLHNFGGNHGLFGALEDVNRGPQA
ARLFPNSTMVGTGIAPEGIGQNEVVYALMAELGWRK

NAGLU

NAGLU
PFAM accession number:PF05089
Interpro abstract (IPR024733):

Alpha-N-acetylglucosaminidase is a lysosomal enzyme that is required for the stepwise degradation of heparan sulphate [(PUBMED:10588735)]. Mutations on the alpha-N-acetylglucosaminidase gene can lead to mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B), characterised by neurological dysfunction but relatively mild somatic manifestations [(PUBMED:12049639)].

Alpha-N-acetylglucosaminidase is composed of three domains. This entry represents the central domain, which has a tim barrel fold [(PUBMED:18443291)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAGLU