The domain within your query sequence starts at position 471 and ends at position 731; the E-value for the NAGLU_C domain shown below is 4.5e-85.

AWVSSFAIRRYGVSQPDAVAAWKLLLRSVYNCSGEACSGHNRSPLVKRPSLQMSTAVWYN
RSDVFEAWRLLLTAAPNLTTSPAFRYDLLDVTRQAVQELVSLCYEEARTAYLKQELDLLL
RAGGLLVYKLLPTLDELLASSSHFLLGTWLDQARKAAVSEAEAQFYEQNSRYQITLWGPE
GNILDYANKQLAGLVADYYQPRWCLFLGTLAHSLARGVPFQQHEFEKNVFPLEQAFVYNK
KRYPSQPRGDTVDLSKKIFLK

NAGLU_C

NAGLU_C
PFAM accession number:PF12972
Interpro abstract (IPR024732):

Alpha-N-acetylglucosaminidase is a lysosomal enzyme required for the stepwise degradation of heparan sulphate [(PUBMED:10588735)]. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB, or Sanfilippo syndrome type B) characterised by neurological dysfunction but relatively mild somatic manifestations [(PUBMED:12049639)]. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold [(PUBMED:18443291)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAGLU_C