SMART: Pfam domain NAGLU

The domain within your query sequence starts at position 28 and ends at position 114; the E-value for the NAGLU_N domain shown below is 4.8e-24.

KAVRELVVRLLGPGPAANFLVSVERALADESGLDTYSLSGGGGVPVLVRGSTGVAAAAGL
HRYLRDFCGCQVAWSSAQLHLPWPLPA

NAGLU_N

PFAM accession number:	PF12971
Interpro abstract (IPR024240):	Alpha-N-acetylglucosaminidase, is a lysosomal enzyme required for the stepwise degradation of heparan sulphate [ (PUBMED:10588735) ]. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterised by neurological dysfunction but relatively mild somatic manifestations [ (PUBMED:12049639) ]. The structure shows that the enzyme is composed of three domains. This entry represents the N-terminal domain of Alpha-N-acetylglucosaminidase which has an alpha-beta fold [ (PUBMED:18443291) ].

PFAM accession number:

PF12971

Interpro abstract (IPR024240):

Alpha-N-acetylglucosaminidase, is a lysosomal enzyme required for the stepwise degradation of heparan sulphate [ (PUBMED:10588735) ]. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterised by neurological dysfunction but relatively mild somatic manifestations [ (PUBMED:12049639) ]. The structure shows that the enzyme is composed of three domains.

This entry represents the N-terminal domain of Alpha-N-acetylglucosaminidase which has an alpha-beta fold [ (PUBMED:18443291) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAGLU_N