SMART: Pfam domain NAGidase

The domain within your query sequence starts at position 62 and ends at position 361; the E-value for the NAGidase domain shown below is 2.5e-84.

CGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLMT
LISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNMC
AADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEKL
LPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRST
ELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLEN

NAGidase

PFAM accession number:	PF07555
Interpro abstract (IPR011496):	This family consists of both eukaryotic and prokaryotic hyaluronidases. Human Q9HAR0 is expressed during meningioma [ (PUBMED:9811929) ]. Clostridium perfringens, P26831 is involved in pathogenesis and is likely to act on connectivity tissue during gas gangrene [ (PUBMED:8177218) ]. It catalyses the random hydrolysis of 1->4-linkages between N-acetyl-beta-D-glucosamine and D-glucuronate residues in hyaluronate.

PFAM accession number:

PF07555

Interpro abstract (IPR011496):

This family consists of both eukaryotic and prokaryotic hyaluronidases. Human Q9HAR0 is expressed during meningioma [ (PUBMED:9811929) ]. Clostridium perfringens, P26831 is involved in pathogenesis and is likely to act on connectivity tissue during gas gangrene [ (PUBMED:8177218) ]. It catalyses the random hydrolysis of 1->4-linkages between N-acetyl-beta-D-glucosamine and D-glucuronate residues in hyaluronate.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAGidase