The domain within your query sequence starts at position 275 and ends at position 439; the E-value for the NAPRTase domain shown below is 2.8e-12.
YALAFPRAFQGLLDSYSVRRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAKEIRGI FRTAGAQFQMPWLESVPIAVSNNIDESELMRLAQKGSEVNVIGIGTSVVTCPKQPSMGCV YKVKTMFGSSWCL
NAPRTase |
---|
PFAM accession number: | PF04095 |
---|---|
Interpro abstract (IPR041525): | Nicotinate phosphoribosyltransferase ( EC 2.4.2.11 ) is the rate-limiting enzyme that catalyses the first reaction in the NAD salvage synthesis [ (PUBMED:18490451) ]. Members in this family can be split into two further subfamilies represented in IPR006405 and IPR006406 . Members in IPR006405 have a different (longer) spacing of several key motifs and have an additional C-terminal domain of up to 100 residues. However, one argument suggesting that this family represents the same enzyme is that no species has a member of both subfamilies. Another is that the gene encoding this protein is located near other NAD salvage biosynthesis genes in Nostoc and in at least four different Gram-positive bacteria. Nicotinamide phosphoribosyl transferase (NAMPT) catalyses the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD [ (PUBMED:19149599) (PUBMED:19109034) ]. NAMPT is also known as pre-B cell colony-enhancing factor (PBEF) or visfatin. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAPRTase