The domain within your query sequence starts at position 129 and ends at position 414; the E-value for the NB-ARC domain shown below is 1.7e-77.

RKKLVHAIQQKLWKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSLLEGCFSGGVHWVSIG
KQDKSGLLMKLQNLCMRLDQEESFSQRLPLNIEEAKDRLRVLMLRKHPRSLLILDDVWDP
WVLKAFDNQCQILLTTRDKSVTDSVMGPKHVVPVESGLGREKGLEILSLFVNMKKEDLPA
EAHSIIKECKGSPLVVSLIGALLRDFPNRWAYYLRQLQNKQFKRIRKSSSYDYEALDEAM
SISVEMLREDIKDYYTDLSILQKDVKVPTKVLCVLWDLETEEVEDI

NB-ARC

NB-ARC
PFAM accession number:PF00931
Interpro abstract (IPR002182):

This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [(PUBMED:9545207)]. This domain has been structurally characterised in the human protein apoptotic protease-activating factor 1 (Apaf-1) [(PUBMED:15829969)]. It contains the three-layered alpha-beta fold and subsequent short alpha-helical region characteristic of the AAA+ ATPase domain superfamily. While this domain is thought to bind and hyrolyse ATP, only ADP binding has been experimentally verified. It is proposed that binding and hydrolysis of ATP by this domain induces conformational changes the the overall protein, leading to formation of the apoptosome.

GO function:ADP binding (GO:0043531)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NB-ARC