The domain within your query sequence starts at position 34 and ends at position 115; the E-value for the NCD1 domain shown below is 4.4e-51.

MALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKP
LHVRRLQKALREWATNPGLFSQ

NCD1

NCD1
PFAM accession number:PF04904
Interpro abstract (IPR006988): Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of eukaryotic (metazoa) transcription factors [(PUBMED:9418898)]. This entry represents the N-terminal NAB domain, which interacts with the EGR1 inhibitory domain (R1) [(PUBMED:9418898)]. It may also mediate multimerisation.
GO process:negative regulation of transcription, DNA-templated (GO:0045892)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NCD1