The domain within your query sequence starts at position 5 and ends at position 83; the E-value for the NCD1 domain shown below is 1.6e-44.

LPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMASKPLH
VRRLQKALRDWVTNPGLFN

NCD1

NCD1
PFAM accession number:PF04904
Interpro abstract (IPR006988):

Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of eukaryotic (metazoa) transcription factors [ (PUBMED:9418898) ]. This entry represents the N-terminal NAB domain, which interacts with the EGR1 inhibitory domain (R1) [ (PUBMED:9418898) ]. It may also mediate multimerisation.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)
GO function:transcription coregulator activity (GO:0003712)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NCD1