SMART: Pfam domain NCU-G1

The domain within your query sequence starts at position 2 and ends at position 72; the E-value for the NCU-G1 domain shown below is 5.4e-18.

TGPGYWDQYYLCCLLFKPSCSRSMLLGMGFPPVDIFSPLVLGIMAVALGAPGLMFLGGGL
FLLLRHRRYSE

NCU-G1

PFAM accession number:	PF15065
Interpro abstract (IPR029382):	NCU-G1 is a set of highly conserved nuclear proteins rich in proline with a molecular weight of approximately 44kDa. Especially high levels are detected in human prostate, liver and kidney. NCU-G1 is a dual-function family capable of functioning as a transcription factor as well as a nuclear receptor co-activator by stimulating the transcriptional activity of peroxisome proliferator-activated receptor-alpha (PPAR-alpha) [ (PUBMED:18021396) ].

PFAM accession number:

PF15065

Interpro abstract (IPR029382):

NCU-G1 is a set of highly conserved nuclear proteins rich in proline with a molecular weight of approximately 44kDa. Especially high levels are detected in human prostate, liver and kidney. NCU-G1 is a dual-function family capable of functioning as a transcription factor as well as a nuclear receptor co-activator by stimulating the transcriptional activity of peroxisome proliferator-activated receptor-alpha (PPAR-alpha) [ (PUBMED:18021396) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NCU-G1