The domain within your query sequence starts at position 36 and ends at position 85; the E-value for the NDUFA12 domain shown below is 1.3e-11.
GTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPE
NDUFA12 |
---|
PFAM accession number: | PF05071 |
---|---|
Interpro abstract (IPR007763): | This entry includes the NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 (NDUFA12) and the NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 (NDUFAF2). NDUFA12 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) [ (PUBMED:14741580) ]. NDUFA12 is believed not to be involved in catalysis [ (PUBMED:12611891) ]. NDUFAF2 is a paralogue of the structural subunit NDUFA12 and functions as an assembly factor [ (PUBMED:23648483) ]. NADH:ubiquinone oxidoreductase (complex I) ( EC 1.6.5.3 ) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) [ (PUBMED:1470679) ]. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [ (PUBMED:10940377) ], mitochondria, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins [ (PUBMED:18394423) ]. |
GO component: | membrane (GO:0016020) |
GO function: | electron transfer activity (GO:0009055), NADH dehydrogenase (ubiquinone) activity (GO:0008137) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDUFA12