The domain within your query sequence starts at position 5 and ends at position 128; the E-value for the NDUF_B4 domain shown below is 5.5e-67.
KYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHIEDPA LIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGKLDRK FNIS
NDUF_B4 |
 |
|---|
| PFAM accession number: | PF07225 |
|---|---|
| Interpro abstract (IPR009866): | This family contains human NADH-ubiquinone oxidoreductase subunit NDUFB4 and related sequences. NADH:ubiquinone oxidoreductase (complex I) ( EC 1.6.5.3 ) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) [ (PUBMED:1470679) ]. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [ (PUBMED:10940377) ], mitochondria, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins [ (PUBMED:18394423) ]. |
| GO component: | mitochondrion (GO:0005739) |
| GO function: | NADH dehydrogenase (ubiquinone) activity (GO:0008137) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDUF_B4