The domain within your query sequence starts at position 1 and ends at position 119; the E-value for the NDUF_B5 domain shown below is 1.1e-68.
MKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARNFYDGPE KNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFIDHSPKATPDN
NDUF_B5 |
 |
|---|
| PFAM accession number: | PF09781 |
|---|---|
| Interpro abstract (IPR019173): | Members of this family mediate the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone, the reaction that occurs being: NADH + ubiquinone = NAD(+) + ubiquinol [ (PUBMED:16828987) (PUBMED:9425316) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDUF_B5