The domain within your query sequence starts at position 1 and ends at position 128; the E-value for the NDUF_B6 domain shown below is 2e-52.
MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNM VFKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPM RDFPDQHH
NDUF_B6 |
![]() |
---|
PFAM accession number: | PF09782 |
---|---|
Interpro abstract (IPR019174): | The NADH dehydrogenase [ubiquinone] complex performs the first stage of electron transfer from NADH to the respiratory chain. This entry represents an accessory subunit that is not thought to be involved in catalysis [ (PUBMED:1518044) ]. |
GO process: | mitochondrial electron transport, NADH to ubiquinone (GO:0006120) |
GO component: | mitochondrial respiratory chain complex I (GO:0005747) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDUF_B6