The domain within your query sequence starts at position 15 and ends at position 157; the E-value for the NDUF_B8 domain shown below is 2.9e-67.

QRTTRGVVPLEARRAFHMTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGD
YPMLPNRSQHERDPWYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLF
GFVAFMVFMFWVGHVFPSYQPVE

NDUF_B8

 NDUF_B8
PFAM accession number:PF05821
Interpro abstract (IPR008699):

This family consists of several eukaryotic NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 proteins. NADH:ubiquinone oxidoreductase (complex I) is an extremely complicated multiprotein complex located in the inner mitochondrial membrane. Its main function is the transport of electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. Human complex I appears to consist of 41 subunits [ (PUBMED:9878551) ].

GO component:mitochondrion (GO:0005739)
GO function:NADH dehydrogenase (ubiquinone) activity (GO:0008137), NADH dehydrogenase activity (GO:0003954)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NDUF_B8