The domain within your query sequence starts at position 576 and ends at position 685; the E-value for the NEXCaM_BD domain shown below is 3e-44.

TVPSFASLNDCREEKIRKLTPGEMDEIREILSRNLYQIRQRTLSYNRHNLTADTSERQAK
EILIRRRHSLRESLRKDNSSNRERRASTSTSRYLSLPKNTKLPEKLQKKK

NEXCaM_BD

NEXCaM_BD
PFAM accession number:PF16644
Interpro abstract (IPR032103):

This entry represents a coiled-coil domain found as part of the regulatory, C-terminal region of the 12-14 TM sodium/proton exchangers (NHEs) of the solute carrier 9 (SLC9) family in all animal kingdoms. The C- lobe of CaM binds the first alpha-helix of the NHE, or CaM b binging region, and the N-lobe of CaM binds the second helix of CaM b binging region [(PUBMED:21931166)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NEXCaM_BD