The domain within your query sequence starts at position 603 and ends at position 704; the E-value for the NEXCaM_BD domain shown below is 1.5e-34.
SAVSTVSMQNIHPKAVTSDRILPALSKDKEEEIRKILRSNLQKTRQRLRSYNRHTLVADP YEEAWNQMLLRRQKARQLEQKITNYLTVPAHKLDSPTLSRAR
NEXCaM_BD |
 |
|---|
| PFAM accession number: | PF16644 |
|---|---|
| Interpro abstract (IPR032103): | This entry represents a coiled-coil domain found as part of the regulatory, C-terminal region of the 12-14 TM sodium/proton exchangers (NHEs) of the solute carrier 9 (SLC9) family in all animal kingdoms. The C- lobe of CaM binds the first alpha-helix of the NHE, or CaM b binging region, and the N-lobe of CaM binds the second helix of CaM b binging region [ (PUBMED:21931166) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NEXCaM_BD