The domain within your query sequence starts at position 43 and ends at position 100; the E-value for the NGP1NT domain shown below is 4.1e-23.

MYRQKERRNSRGKVIKPLQYQSTVASGTVARVEPNIKWFGNTRVIKQASLQKFQEEMD

NGP1NT

• PFAM accession number: PF08153
• Interpro abstract (IPR012971):

  This N-terminal domain is found in Nucleolar GTP-binding protein 2 [ (PUBMED:11707418) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NGP1NT