The domain within your query sequence starts at position 43 and ends at position 100; the E-value for the NGP1NT domain shown below is 4.1e-23.
MYRQKERRNSRGKVIKPLQYQSTVASGTVARVEPNIKWFGNTRVIKQASLQKFQEEMD
NGP1NT |
---|
PFAM accession number: | PF08153 |
---|---|
Interpro abstract (IPR012971): | This N-terminal domain is found in Nucleolar GTP-binding protein 2 [ (PUBMED:11707418) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NGP1NT