The domain within your query sequence starts at position 43 and ends at position 174; the E-value for the NGP1NT domain shown below is 1.2e-51.

MYRQKERRNSRGKVIKPLQYQSTVASGTVARVEPNIKWFGNTRVIKQASLQKFQEEMDKV
MKDPYKVVMKQSKLPMSLLHDRIQPHNAKVHILDTESFESTFGPKSQRKRPNLFASDMQS
LLENAEMSTESY

NGP1NT

NGP1NT
PFAM accession number:PF08153
Interpro abstract (IPR012971): This N-terminal domain is found in Nucleolar GTP-binding protein 2 [(PUBMED:11707418)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NGP1NT