The domain within your query sequence starts at position 494 and ends at position 613; the E-value for the NHS domain shown below is 3.8e-11.
RERSLSVPTDSGVTSVDYDEEQKTSETRILPYASTSSEGSNSTDNIAALSTEQEARHRRQ RSKSISLKKAKKKPSPPMRSVSLVKDEPALPPEGELVLPKDQRPRSLCLSLEHQGHHPPH
NHS |
---|
PFAM accession number: | PF15273 |
---|---|
Interpro abstract (IPR024845): | Nance-Horan syndrome is an X-linked disorder characterised by congenital cataracts, dental anomalies, dysmorphic features, and, in some cases, mental retardation [ (PUBMED:14564667) ]. The syndrome is caused by defects in the NHS gene [ (PUBMED:15466011) ], which appears to play a key role in the regulation of eye, tooth, brain, and craniofacial development [ (PUBMED:14564667) ]. However, the protein's exact function is unknown. This entry represents the NHS protein family, which includes NHS protein and NHS-like proteins 1 and 2. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NHS