The domain within your query sequence starts at position 494 and ends at position 613; the E-value for the NHS domain shown below is 3.8e-11.

RERSLSVPTDSGVTSVDYDEEQKTSETRILPYASTSSEGSNSTDNIAALSTEQEARHRRQ
RSKSISLKKAKKKPSPPMRSVSLVKDEPALPPEGELVLPKDQRPRSLCLSLEHQGHHPPH

NHS

NHS
PFAM accession number:PF15273
Interpro abstract (IPR024845):

Nance-Horan syndrome is an X-linked disorder characterised by congenital cataracts, dental anomalies, dysmorphic features, and, in some cases, mental retardation [ (PUBMED:14564667) ]. The syndrome is caused by defects in the NHS gene [ (PUBMED:15466011) ], which appears to play a key role in the regulation of eye, tooth, brain, and craniofacial development [ (PUBMED:14564667) ]. However, the protein's exact function is unknown.

This entry represents the NHS protein family, which includes NHS protein and NHS-like proteins 1 and 2.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NHS