The domain within your query sequence starts at position 179 and ends at position 266; the E-value for the NID domain shown below is 1.6e-29.

VMLGFADEEVAQHLCQIGQFRVPLDRQQVLLRVSPYVSGEIQKAEIKFQQAPHSVLVTNI
PDVMDAQELHDILEIHFQKPTRGGGEVE

NID

NID
PFAM accession number:PF07292
Interpro abstract (IPR009909):

This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi). This domain mediates Nmi-Nmi protein interactions and subcellular localisation [ (PUBMED:10950963) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NID