The domain within your query sequence starts at position 31 and ends at position 363; the E-value for the NIF3 domain shown below is 2.5e-77.

ALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMDEALQKKADFILS
YHPPIFRPMKHITWKTWKECLVIRALENRVAVYSPHTAYDAAPQGVNSWLAKGLGTCTTR
PIHPSRAPDYPTEGAHRLEFSVNRSQDLDKVMSTLRGVGGVSVTSFPARCDGEEQTRISL
NCTQKTLMQVLAFLSQDRQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLAIMIERIKT
HLKLSHLRLALGVGRTLESQVKVVALCAGSGGSVLQGVEADLYLTGEMSHHDVLDAASKG
INVILCEHSNTERGFLSELQEMLGVHFENKINI

NIF3

NIF3
PFAM accession number:PF01784
Interpro abstract (IPR002678):

This family includes GTP cyclohydrolase 1 type 2 proteins from bacteria and Nif3 from budding yeasts.

In Helicobacter pylori, GTP cyclohydrolase 1 type 2 converts GTP to dihydroneopterin triphosphate [(PUBMED:23825549)].

Nif3 interacts with the yeast transcriptional coactivator Ngg1p which is part of the ADA complex, the exact function of this interaction is unknown [(PUBMED:11124544), (PUBMED:8663102)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NIF3