The domain within your query sequence starts at position 182 and ends at position 279; the E-value for the NIPSNAP domain shown below is 2.6e-32.
YELRSYQLRPGTMIEWGNYWARAIRFRQDSNEAVGGFFSQIGQLYMVHHLWAYKDLQTRE DIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSP
NIPSNAP |
![]() |
---|
PFAM accession number: | PF07978 |
---|---|
Interpro abstract (IPR012577): | Proteins containing this domain include many hypothetical proteins. It also includes members of the NIPSNAP family, which have putative roles in vesicular transport [ (PUBMED:9661659) ]. This domain is often found in duplicate. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NIPSNAP