The domain within your query sequence starts at position 35 and ends at position 134; the E-value for the NIPSNAP domain shown below is 8e-28.
YEFCTYYLKPASVEEFLYNFKKNVHLRTAHSELVGYWTVGFGGRINTVFHIWKYDNFAHR AAVYKALAKDEDWQEQFLIPNLPLIDKQESEITYLVPWCK
NIPSNAP |
---|
PFAM accession number: | PF07978 |
---|---|
Interpro abstract (IPR012577): | Proteins containing this domain include many hypothetical proteins. It also includes members of the NIPSNAP family, which have putative roles in vesicular transport [ (PUBMED:9661659) ]. This domain is often found in duplicate. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NIPSNAP