The domain within your query sequence starts at position 17 and ends at position 77; the E-value for the NLE domain shown below is 3.6e-15.
LLVQFQDEGGQLLGSPFDVPVDITPDKLQLVCNALLAQEEPLPLAFYVHDAEIVSSLGKT L
NLE |
---|
PFAM accession number: | PF08154 |
---|---|
Interpro abstract (IPR012972): | This domain is located N-terminal to WD40 repeats( IPR001680 ). It is found in the microtubule-associated protein Q12024 [ (PUBMED:15112237) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NLE