The domain within your query sequence starts at position 3 and ends at position 70; the E-value for the NLE domain shown below is 3.2e-22.

QLQARFYSENKKYAVDDVPFSIPAAAEVADLSNIINKLLETKNELHKHVEFDFLIKGQFL
RVPLVKHM

NLE

NLE
PFAM accession number:PF08154
Interpro abstract (IPR012972):

This domain is located N-terminal to WD40 repeats(IPR001680). It is found in the microtubule-associated protein Q12024 [(PUBMED:15112237)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NLE