The domain within your query sequence starts at position 17 and ends at position 246; the E-value for the NMD3 domain shown below is 6.6e-82.
CCECGVPISPNPANICVACLRSKVDISQGVPKQVSISFCKQCQRYFQPPASWVQCALESR ELLALCLKKIKAPLSKVRLVDAGFVWTEPHSKRLKVKLTIQKEVMNGAILQQVFVVDYVV QSQMCGDCHRVEAKDFWKAVIQVRQKTLHKKTFYYLEQLILKYGMHQNTLRIKEIHDGLD FYYSSKQHAQKMVEFLQGIVPCRYKASQRLISQDIHSNTYNYKSTFSVEI
NMD3 |
---|
PFAM accession number: | PF04981 |
---|---|
Interpro abstract (IPR007064): | Nmd3 acts as an adapter for the XPO1/CRM1-mediated export of the 60S ribosomal subunit [ (PUBMED:12773398) (PUBMED:11086007) ]. This N-terminal region contains four conserved CXXC motifs that could be metal binding. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NMD3