The domain within your query sequence starts at position 310 and ends at position 497; the E-value for the NMT_C domain shown below is 6.4e-88.
EVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKAVRELINIYLKQFHLAPVMD DAEVAHWFLPREHIIDTFVVENPSGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHT ETPLLDLMNDALIIAKLKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTD SEKVGLVL
NMT_C |
---|
PFAM accession number: | PF02799 |
---|---|
Interpro abstract (IPR022677): | Myristoyl-CoA:protein N-myristoyltransferase ( EC 2.3.1.97 ) (Nmt) [ (PUBMED:8322618) ] is the enzyme responsible for transferring a myristate group on the N-terminal glycine of a number of cellular eukaryotics and viral proteins. Nmt is a monomeric protein of about 50 to 60kDa whose sequence appears to be well conserved. The N and C-terminal domains of NMT are structurally similar, each adopting an acyl-CoA N-acyltransferase-like fold. This entry represents the C-terminal region. |
GO function: | glycylpeptide N-tetradecanoyltransferase activity (GO:0004379) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NMT_C