The domain within your query sequence starts at position 212 and ends at position 307; the E-value for the NOC3p domain shown below is 1.5e-32.
DKKIQIAALASAILSDPESHIKKLKELRSMLMEQDPDVAVTVRKLVIISLMELFKDITPS YKIRPLTEAEKSTKIRKETQKLREFEEGLVSQYKFY
NOC3p |
![]() |
---|
PFAM accession number: | PF07540 |
---|---|
Interpro abstract (IPR011501): | This entry represents the N-terminal domain of the nucleolar complex-associated protein (Noc3), which is conserved in eukaryotes and plays essential roles in replication and rRNA processing in Saccharomyces cerevisiae [ (PUBMED:12110182) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NOC3p