The domain within your query sequence starts at position 5 and ends at position 70; the E-value for the NOP5NT domain shown below is 4.3e-20.

HVLFEHAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENA
NAVSEG

NOP5NT

NOP5NT
PFAM accession number:PF08156
Interpro abstract (IPR012974):

This N-terminal domain is found in RNA-binding proteins of the NOP5 family [(PUBMED:15112237)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NOP5NT