The domain within your query sequence starts at position 28 and ends at position 283; the E-value for the NPC1_N domain shown below is 8.7e-74.

KAGFCTFYEECGKNPELSGGLTSLSNISCLSNTPARHVTGDHLALLQRVCPRLYNGPNDT
YACCSTKQLVSLDSSLSITKALLTRCPACSENFVSIHCHNTCSPDQSLFINVTRVVQRDP
GQLPAVVAYEAFYQRSFAEKAYESCSRVRIPAAASLAVGSMCGVYGSALCNAQRWLNFQG
DTGNGLAPLDITFHLLEPGQALADGMKPLDGKITPCNESQGEDSAACSCQDCAASCPVIP
PPPALRPSFYMGRMPG

NPC1_N

NPC1_N
PFAM accession number:PF16414
Interpro abstract (IPR032190):

This is the N-terminal domain of Niemann-Pick C1 family proteins, which mediate transport of cholesterol from the intestinal lumen to enterocytes. This domain contains a cholesterol-binding pocket [(PUBMED:10783261), (PUBMED:21525977)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NPC1_N