The domain within your query sequence starts at position 1 and ends at position 142; the E-value for the NPDC1 domain shown below is 1.8e-88.

MATPVPPPSPRHLRLLRLLLSGLILGAALNGATARRPDATTCPGSLDCALKRRAKCPPGA
HACGPCLQSFQEDQRGFCVPRKHLSSVVTMETKIVKLWMGPSISGGCLLQELALKEKEAG
HSRLTAQPLLEAAQKLLEPAA

NPDC1

NPDC1
PFAM accession number:PF06809
Interpro abstract (IPR009635):

This family consists of several neural proliferation differentiation control-1 (NPDC1) proteins. NPDC1 plays a role in the control of neural cell proliferation and differentiation. It has been suggested that NPDC1 may be involved in the development of several secretion glands. This family also contains the C-terminal region of the Caenorhabditis elegans protein CAB-1 (Q93249) which is known to interact with AEX-3 [(PUBMED:10970871)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NPDC1