The domain within your query sequence starts at position 451 and ends at position 525; the E-value for the NPL4 domain shown below is 3e-15.

DDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQT
WKKSEQWATIEQLCS

NPL4

NPL4
PFAM accession number:PF05021
Interpro abstract (IPR007717): The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport. Using a diverse set of substrates and direct ubiquitination assays, analysis revealed that HRD4/NPL4 is required for a poorly characterised step in ER-associated degradation following ubiquitination of target proteins but preceding their recognition by the 26S proteasome [(PUBMED:11739805)]. Npl4p physically associates with Cdc48p via Ufd1p to form a Cdc48p-Ufd1p-Npl4p complex. The Cdc48-Ufd1-Npl4 complex functions in the recognition of several polyubiquitin-tagged proteins and facilitates their presentation to the 26S proteasome for processive degradation or even more specific processing [(PUBMED:11574150)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NPL4