The domain within your query sequence starts at position 223 and ends at position 271; the E-value for the NPM1-C domain shown below is 8.1e-38.

EDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS

NPM1-C

NPM1-C
PFAM accession number:PF16276
Interpro abstract (IPR032569):

This domain, approximately 50 residues in length, is mainly found in C-terminal region of nucleophosmin from animals [ (PUBMED:16794633) ]. Nucleophosmin (also known as NPM1/B23) is a multifunctional protein that is involved in a number of cellular activities, such as ribosome maturatation and export, centrosome duplication, and response to stress stimuli [ (PUBMED:16794633) ]. Although it shuttles rapidly between the nucleus and the cytoplasm, a large fraction of NPM1/B23 resides in the nucleoli [ (PUBMED:16041368) ]. Mutations of the NPM1 gene has been linked to acute myeloid leukemia [ (PUBMED:22707729) ].

This domain has a three-helix bundle which binds the G-quadruplex DNA at the interface between helices H1 and H2 through electrostatic interactions with the G-quadruplex phosphate backbone [ (PUBMED:22707729) (PUBMED:24952945) ].

GO function:nucleic acid binding (GO:0003676)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NPM1-C