The domain within your query sequence starts at position 2 and ends at position 156; the E-value for the NPR2 domain shown below is 1.2e-52.

GSSCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAME
KKLIGCPVCIEHKKYSRNALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELESSFVSN
EESKQKLVPIMTILLEELNASGRCTLPIGDRAAAR

NPR2

NPR2
PFAM accession number:PF06218
Interpro abstract (IPR009348):

This family of regulators are involved in post-translational control of nitrogen permease. In mammals, it may act as a tumor suppressor that suppresses cell growth and enhances sensitivity to various anticancer drugs [(PUBMED:18616680), (PUBMED:19521502)].

This entry also includes the GATOR complex protein NPRL2. The GATOR1 complex functions as an inhibitor of the amino acid-sensing branch of the mTORC1 pathway. The mTORC1 pathway promotes cell growth in response to various factors including amino acids. Rag guanosine triphosphatases promote translocation of mTORC1 to the lysosomal membrane, where it is activated [(PUBMED:23723238)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NPR2