The domain within your query sequence starts at position 63 and ends at position 108; the E-value for the NPR3 domain shown below is 8.3e-15.

RFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQAN

NPR3

NPR3
PFAM accession number:PF03666
Interpro abstract (IPR005365):

This protein, also known in yeasts as Rmd11, complexes with NPR2, IPR009348. This complex heterodimer is responsible for inactivating TORC1, an evolutionarily conserved protein complex that controls cell size via nutritional input signals, specifically, in response to amino acid starvation [(PUBMED:19521502)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NPR3