The domain within your query sequence starts at position 318 and ends at position 658; the E-value for the NRDE-2 domain shown below is 1.2e-107.

ARVEEFNRRVRENPWDTQLWMAFVAFQDEVMRSPGIYALGEGEQEKHRKSLKLLLEKKLA
VLERAIESNPGSVELKLAKLQLCSEFWEPSALAKEWQKLLFLHPNNTSLWQRYLSFCQSQ
FGTFSVSKLHSLYGKCLSTLSAVKDGSMLSHPVLPGTEEAMFGLFLQQCHFLRQAGHSEK
VISLFQAMVDFTFFKPDSVKELPTKVQVEFFEPFWDSGEPRVGEKGARGWRAWMHQQERG
GWVLITPDEDDEEPEEEDQEIKDKTLPRWQIWLAVERSRDQRHWRPWRPDKTKKQTEEDC
EDPERQVLFDDIGQSLIRLSSPDLQFQLIQAFLQFLGVPSG

NRDE-2

NRDE-2
PFAM accession number:PF08424
Interpro abstract (IPR013633):

Eukaryotic cells express a wide variety of endogenous small regulatory RNAs that regulate heterochromatin formation, developmental timing, defence against parasitic nucleic acids, and genome rearrangement. Many small regulatory RNAs are thought to function in nuclei, and in plants and fungi small interfering RNAs (siRNAs) associate with nascent transcripts and direct chromatin and/or DNA modifications. NRDE-2, is required for siRNA-mediated silencing in nuclei. NRDE-2 associates with the Argonaute protein NRDE-3 within nuclei and is recruited by NRDE-3/siRNA complexes to nascent transcripts that have been targeted by RNA interference, RNAi, the process whereby double-stranded RNA directs the sequence-specific degradation of mRNA [(PUBMED:20543824)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NRDE-2