SMART: Pfam domain NRIP1_repr

The domain within your query sequence starts at position 412 and ends at position 739; the E-value for the NRIP1_repr_2 domain shown below is 7.5e-122.

PTTIDEYSDNNPSFTDDSSGDESSYSNCVPIDLSCKHRIEKPEAERPVSLENLTQSLLNT
WDPKIPGVDIKEDQDTSTNSKLNSHQKVTLLQLLLGHKSEETVERNASPQDIHSDGTKFS
PQNYTRTSVIESPSTNRTTPVSTPPLYTASQAESPINLSQHSLVIKWNSPPYACSTPASK
LTNTAPSHLMDLTKGKESQAEKPAPSEGAQNSATFSASKLLQNLAQCGLQSSGPGEEQRP
CKQLLSGNPDKPLGLIDRLNSPLLSNKTNAAEESKAFSSQPAGPEPGLPGCEIENLLERR
TVLQLLLGNSSKGKNEKKEKTPARDEAP

NRIP1_repr_2

PFAM accession number:	PF15688
Interpro abstract (IPR031406):	This domain is the second repression domain of nuclear receptor-interacting protein 1 [ (PUBMED:14736873) (PUBMED:15060175) ]. Nuclear receptor-interacting protein 1 (also known as nuclear factor RIP140) modulates transcriptional activation by steroid receptors such as NR3C1, NR3C2 and ESR1 [ (PUBMED:7641693) ]. It also modulates transcriptional repression by nuclear hormone receptors [ (PUBMED:10364267) ] and clock gene expression [ (PUBMED:21628546) ]. It consists of four distinct autonomous repression domains [ (PUBMED:14736873) ].

PFAM accession number:

PF15688

Interpro abstract (IPR031406):

This domain is the second repression domain of nuclear receptor-interacting protein 1 [ (PUBMED:14736873) (PUBMED:15060175) ].

Nuclear receptor-interacting protein 1 (also known as nuclear factor RIP140) modulates transcriptional activation by steroid receptors such as NR3C1, NR3C2 and ESR1 [ (PUBMED:7641693) ]. It also modulates transcriptional repression by nuclear hormone receptors [ (PUBMED:10364267) ] and clock gene expression [ (PUBMED:21628546) ]. It consists of four distinct autonomous repression domains [ (PUBMED:14736873) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NRIP1_repr_2