The domain within your query sequence starts at position 31 and ends at position 120; the E-value for the NRN1 domain shown below is 1e-47.

CDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDM
WDKLRKESKNLNIQGSLFELCGSSNGAAGS

NRN1

NRN1
PFAM accession number:PF15056
Interpro abstract (IPR026144):

This entry represents the neuritin family of proteins, including neuritin-A and B from Xenopus laevis and neuritin-like protein from human and mouse. Neuritin has been shown to promote neurite outgrowth and arborisation in primary embryonic hippocampal and cortical cultures [ (PUBMED:9122250) ]. Its expression is induced by neuronal activity and by the activity-regulated neurotrophins BDNF and NT-3 [ (PUBMED:9122250) ].

GO process:nervous system development (GO:0007399)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NRN1