The domain within your query sequence starts at position 11 and ends at position 133; the E-value for the NTF2 domain shown below is 5.8e-35.

VGREFVRQYYTLLNQAPDMLHRFYGKNSSYAHGGLDSNGKPADAVYGQKEIHRKVMSQNF
TNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDI
FRY

NTF2

NTF2
PFAM accession number:PF02136
Interpro abstract (IPR002075):

Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. NTF2 folds into a cone with a deep hydrophobic cavity, the opening of which is surrounded by several negatively charged residues. RanGDP binds to NTF2 by inserting a conserved phenylalanine residue into the hydrophobic pocket of NTF2 and making electrostatic interactions with the conserved negatively charged residues that surround the cavity [(PUBMED:9533885)].

This entry represent the main structural domain of NTF2 and related domains.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NTF2