The domain within your query sequence starts at position 1 and ends at position 150; the E-value for the NTP_transferase domain shown below is 2.3e-15.
RFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEALTQFLEAAQQE FNLPVRYLQEFAPLGTGGGLYHFRDQILAGAPEAFFVLNADVCSDFPLSAMLEAHRRQRH PFLLLGTTANRTQSLNYGCIVENPQTHEKP
NTP_transferase |
---|
PFAM accession number: | PF00483 |
---|---|
Interpro abstract (IPR005835): | Nucleotidyl transferases transfer nucleotides from one compound to another. This domain is found in a number of enzymes that transfer nucleotides onto phosphosugars [ (PUBMED:9507048) ]. |
GO process: | biosynthetic process (GO:0009058) |
GO function: | nucleotidyltransferase activity (GO:0016779) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NTP_transferase