The domain within your query sequence starts at position 3 and ends at position 91; the E-value for the NTP_transferase domain shown below is 5.2e-15.

KAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPD
EALTQFLEAAQQEFNLPVRYLQEFAPLGT

NTP_transferase

NTP_transferase
PFAM accession number:PF00483
Interpro abstract (IPR005835):

Nucleotidyl transferases transfer nucleotides from one compound to another. This domain is found in a number of enzymes that transfer nucleotides onto phosphosugars [ (PUBMED:9507048) ].

GO process:biosynthetic process (GO:0009058)
GO function:nucleotidyltransferase activity (GO:0016779)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NTP_transferase