The domain within your query sequence starts at position 4 and ends at position 107; the E-value for the NTPase_1 domain shown below is 1.4e-40.
HVFLTGPPGVGKTTLIQKAIEVLQSSGLPVDGFYTQEVRQEGKRIGFDVVTLSGAQGPLS RVGSQPLPGKPECRVGQYVVNLDSFEQLALPVLRNHQEASDDIP
NTPase_1 |
![]() |
---|
PFAM accession number: | PF03266 |
---|---|
Interpro abstract (IPR004948): | This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [ (PUBMED:17291528) ]. It includes proteins from bacteria to human, and the function was determined first in a hyperthermophilic bacterium to be an NTPase [ (PUBMED:14503925) ]. The structure of one member-sequence represents a variation of the RecA fold, and implies that the function might be that of a DNA/RNA modifying enzyme [ (PUBMED:15777481) ]. The sequence carries both a Walker A and Walker B motif which together are characteristic of ATPases or GTPases. The protein exhibits an increased expression profile in human liver cholangiocarcinoma when compared to normal tissue [ (PUBMED:17291528) ]. |
GO function: | nucleoside-triphosphatase activity (GO:0017111) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NTPase_1