The domain within your query sequence starts at position 56 and ends at position 145; the E-value for the NTPase_1 domain shown below is 5.4e-27.

ASVQSWAGSSCGPKHRVCIIDEIGKMELFSQPFIQAVRQMLSTPGIIVVGTIPVPKGKPL
ALVEEIRKRRDVKVFNVTRDNRNSLLPDIV

NTPase_1

NTPase_1
PFAM accession number:PF03266
Interpro abstract (IPR004948):

This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [(PUBMED:17291528)]. It includes proteins from bacteria to human, and the function was determined first in a hyperthermophilic bacterium to be an NTPase [(PUBMED:14503925)]. The structure of one member-sequence represents a variation of the RecA fold, and implies that the function might be that of a DNA/RNA modifying enzyme [(PUBMED:15777481)]. The sequence carries both a Walker A and Walker B motif which together are characteristic of ATPases or GTPases. The protein exhibits an increased expression profile in human liver cholangiocarcinoma when compared to normal tissue [(PUBMED:17291528)].

GO function:nucleotide phosphatase activity, acting on free nucleotides (GO:0098519)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NTPase_1